Lineage for d1kobb_ (1kob B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 875176Protein Twitchin, kinase domain [56126] (2 species)
    CaMK group; CAMKI subfamily; serine/threonine kinase
  7. 875179Species California sea hare (Aplysia californica), twk43 [TaxId:6500] [56127] (1 PDB entry)
  8. 875181Domain d1kobb_: 1kob B: [41641]

Details for d1kobb_

PDB Entry: 1kob (more details), 2.3 Å

PDB Description: twitchin kinase fragment (aplysia), autoregulated protein kinase domain
PDB Compounds: (B:) twitchin

SCOP Domain Sequences for d1kobb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kobb_ d.144.1.7 (B:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]}
indydkfyediwkkyvpqpvevkqgsvydyydileelgsgafgvvhrcvekatgrvfvak
fintpypldkytvkneisimnqlhhpklinlhdafedkyemvlileflsggelfdriaae
dykmseaevinymrqaceglkhmhehsivhldikpenimcetkkassvkiidfglatkln
pdeivkvttataefaapeivdrepvgfytdmwaigvlgyvllsglspfageddletlqnv
krcdwefdedafssvspeakdfiknllqkeprkrltvhdalehpwlkgdhsnltsripss
rynkirqkikekyadwpapqpaigrianfsslrkhrpqeyqiydsyfdrkea

SCOP Domain Coordinates for d1kobb_:

Click to download the PDB-style file with coordinates for d1kobb_.
(The format of our PDB-style files is described here.)

Timeline for d1kobb_: