Lineage for d1koba_ (1kob A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435479Protein Twitchin, kinase domain [56126] (2 species)
    CaMK group; CAMKI subfamily; serine/threonine kinase
  7. 1435482Species California sea hare (Aplysia californica), twk43 [TaxId:6500] [56127] (1 PDB entry)
  8. 1435483Domain d1koba_: 1kob A: [41640]
    complexed with val

Details for d1koba_

PDB Entry: 1kob (more details), 2.3 Å

PDB Description: twitchin kinase fragment (aplysia), autoregulated protein kinase domain
PDB Compounds: (A:) twitchin

SCOPe Domain Sequences for d1koba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]}
indydkfyediwkkyvpqpvevkqgsvydyydileelgsgafgvvhrcvekatgrvfvak
fintpypldkytvkneisimnqlhhpklinlhdafedkyemvlileflsggelfdriaae
dykmseaevinymrqaceglkhmhehsivhldikpenimcetkkassvkiidfglatkln
pdeivkvttataefaapeivdrepvgfytdmwaigvlgyvllsglspfageddletlqnv
krcdwefdedafssvspeakdfiknllqkeprkrltvhdalehpwlkgdhsnltsripss
rynkirqkikekyadwpapqpaigrianfsslrkhrpqeyqiydsyfdrkea

SCOPe Domain Coordinates for d1koba_:

Click to download the PDB-style file with coordinates for d1koba_.
(The format of our PDB-style files is described here.)

Timeline for d1koba_: