SCOP 1.71: Domain d1koba_: 1kob A:

Lineage for d1koba_ (1kob A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Twitchin, kinase domain [56126] (2 species)
   CaMK group; CAMKI subfamily; serine/threonine kinase

7. Species California sea hare (Aplysia californica), twk43 [TaxId:6500] [56127] (1 PDB entry)

8. Domain d1koba_: 1kob A: [41640]

Details for d1koba_

PDB Entry: 1kob, 2.3 Å

PDB Description: twitchin kinase fragment (aplysia), autoregulated protein kinase domain

SCOP Domain Sequences for d1koba_:

Sequence; same for both SEQRES and ATOM records:

>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43}
indydkfyediwkkyvpqpvevkqgsvydyydileelgsgafgvvhrcvekatgrvfvak
fintpypldkytvkneisimnqlhhpklinlhdafedkyemvlileflsggelfdriaae
dykmseaevinymrqaceglkhmhehsivhldikpenimcetkkassvkiidfglatkln
pdeivkvttataefaapeivdrepvgfytdmwaigvlgyvllsglspfageddletlqnv
krcdwefdedafssvspeakdfiknllqkeprkrltvhdalehpwlkgdhsnltsripss
rynkirqkikekyadwpapqpaigrianfsslrkhrpqeyqiydsyfdrkeav

Timeline for d1koba_:

• d1koba_ first appeared (with stable ids) in SCOP 1.55
  
• d1koba_ appears in SCOP 1.69
  
• d1koba_ appears in SCOP 1.73
  
• d1koba_ appears in the current release, SCOPe 2.08