Lineage for d1koba_ (1kob A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) 
Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins) 
Protein Twitchin, kinase domain [56126] (2 species) Species California sea hare (Aplysia californica), twk43 [TaxId:6500] [56127] (1 PDB entry) 
Domain d1koba_: 1kob A: [41640]
Details for d1koba_
PDB Entry: 1kob (more details), 2.3 Å
PDB Description: twitchin kinase fragment (aplysia), autoregulated protein kinase domain
SCOP Domain Sequences for d1koba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1koba_ d.144.1.1 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43}
indydkfyediwkkyvpqpvevkqgsvydyydileelgsgafgvvhrcvekatgrvfvak
fintpypldkytvkneisimnqlhhpklinlhdafedkyemvlileflsggelfdriaae
dykmseaevinymrqaceglkhmhehsivhldikpenimcetkkassvkiidfglatkln
pdeivkvttataefaapeivdrepvgfytdmwaigvlgyvllsglspfageddletlqnv
krcdwefdedafssvspeakdfiknllqkeprkrltvhdalehpwlkgdhsnltsripss
rynkirqkikekyadwpapqpaigrianfsslrkhrpqeyqiydsyfdrkeav
SCOP Domain Coordinates for d1koba_:
Click to download the PDB-style file with coordinates for d1koba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1koba_:
- d1koba_ appears in SCOP 1.57
- d1koba_ appears in the current release, SCOPe 2.08
View in 3D
