Lineage for d1tkia_ (1tki A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1221388Protein Titin, kinase domain [56124] (1 species)
    CaMK group; CAMKI subfamily; serine/threonine kinase
  7. 1221389Species Human (Homo sapiens) [TaxId:9606] [56125] (1 PDB entry)
  8. 1221390Domain d1tkia_: 1tki A: [41638]

Details for d1tkia_

PDB Entry: 1tki (more details), 2 Å

PDB Description: autoinhibited serine kinase domain of the giant muscle protein titin
PDB Compounds: (A:) titin

SCOPe Domain Sequences for d1tkia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]}
kelyekymiaedlgrgefgivhrcvetsskktymakfvkvkgtdqvlvkkeisilniarh
rnilhlhesfesmeelvmifefisgldiferintsafelnereivsyvhqvcealqflhs
hnighfdirpeniiyqtrrsstikiiefgqarqlkpgdnfrllftapeyyapevhqhdvv
statdmwslgtlvyvllsginpflaetnqqiienimnaeytfdeeafkeisieamdfvdr
llvkerksrmtasealqhpwlkqkiervstkvirtlkhrryyhtlikkdlnmvvsaaris
cggairsqkgvsvakvkvasi

SCOPe Domain Coordinates for d1tkia_:

Click to download the PDB-style file with coordinates for d1tkia_.
(The format of our PDB-style files is described here.)

Timeline for d1tkia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tkib_