Lineage for d2phka_ (2phk A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1042954Protein gamma-subunit of glycogen phosphorylase kinase (Phk) [56122] (1 species)
    CaMK group; CAMKI subfamily; serine/threonine kinase
  7. 1042955Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [56123] (3 PDB entries)
  8. 1042958Domain d2phka_: 2phk A: [41637]
    complexed with atp, gol, mn

Details for d2phka_

PDB Entry: 2phk (more details), 2.6 Å

PDB Description: the crystal structure of a phosphorylase kinase peptide substrate complex: kinase substrate recognition
PDB Compounds: (A:) phosphorylase kinase

SCOPe Domain Sequences for d2phka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gfyenyepkeilgrgvssvvrrcihkptckeyavkiidvtgggsfsaeevqelreatlke
vdilrkvsghpniiqlkdtyetntffflvfdlmkkgelfdyltekvtlseketrkimral
levicalhklnivhrdlkpenilldddmnikltdfgfscqldpgeklrevcgtpsylape
iiecsmndnhpgygkevdmwstgvimytllagsppfwhrkqmlmlrmimsgnyqfgspew
ddysdtvkdlvsrflvvqpqkrytaeealahpffqqy

SCOPe Domain Coordinates for d2phka_:

Click to download the PDB-style file with coordinates for d2phka_.
(The format of our PDB-style files is described here.)

Timeline for d2phka_: