SCOP 1.71: Domain d2phka_: 2phk A:

Lineage for d2phka_ (2phk A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein gamma-subunit of glycogen phosphorylase kinase (Phk) [56122] (1 species)
   CaMK group; CAMKI subfamily; serine/threonine kinase

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [56123] (3 PDB entries)

8. Domain d2phka_: 2phk A: [41637]
   complexed with atp, gol, mn

Details for d2phka_

PDB Entry: 2phk, 2.6 Å

PDB Description: the crystal structure of a phosphorylase kinase peptide substrate complex: kinase substrate recognition

SCOP Domain Sequences for d2phka_:

Sequence; same for both SEQRES and ATOM records:

>d2phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus)}
gfyenyepkeilgrgvssvvrrcihkptckeyavkiidvtgggsfsaeevqelreatlke
vdilrkvsghpniiqlkdtyetntffflvfdlmkkgelfdyltekvtlseketrkimral
levicalhklnivhrdlkpenilldddmnikltdfgfscqldpgeklrevcgtpsylape
iiecsmndnhpgygkevdmwstgvimytllagsppfwhrkqmlmlrmimsgnyqfgspew
ddysdtvkdlvsrflvvqpqkrytaeealahpffqqy

Timeline for d2phka_:

• d2phka_ first appeared (with stable ids) in SCOP 1.55
  
• d2phka_ appears in SCOP 1.69
  
• d2phka_ appears in SCOP 1.73
  
• d2phka_ appears in the current release, SCOPe 2.08