Lineage for d2phka_ (2phk A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138043Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 138044Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 138045Family d.144.1.1: Serine/threonin kinases [56113] (17 proteins)
  6. 138129Protein gamma-subunit of glycogen phosphorylase kinase (Phk) [56122] (1 species)
  7. 138130Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [56123] (3 PDB entries)
  8. 138133Domain d2phka_: 2phk A: [41637]

Details for d2phka_

PDB Entry: 2phk (more details), 2.6 Å

PDB Description: the crystal structure of a phosphorylase kinase peptide substrate complex: kinase substrate recognition

SCOP Domain Sequences for d2phka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2phka_ d.144.1.1 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus)}
gfyenyepkeilgrgvssvvrrcihkptckeyavkiidvtgggsfsaeevqelreatlke
vdilrkvsghpniiqlkdtyetntffflvfdlmkkgelfdyltekvtlseketrkimral
levicalhklnivhrdlkpenilldddmnikltdfgfscqldpgeklrevcgtpsylape
iiecsmndnhpgygkevdmwstgvimytllagsppfwhrkqmlmlrmimsgnyqfgspew
ddysdtvkdlvsrflvvqpqkrytaeealahpffqqy

SCOP Domain Coordinates for d2phka_:

Click to download the PDB-style file with coordinates for d2phka_.
(The format of our PDB-style files is described here.)

Timeline for d2phka_: