Lineage for d1a06a_ (1a06 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542660Protein Calmodulin-dependent protein kinase [56120] (1 species)
    CaMK group; CAMKI subfamily; serine/threonine kinase
  7. 2542661Species Norway rat (Rattus norvegicus) [TaxId:10116] [56121] (1 PDB entry)
  8. 2542662Domain d1a06a_: 1a06 A: [41634]

Details for d1a06a_

PDB Entry: 1a06 (more details), 2.5 Å

PDB Description: calmodulin-dependent protein kinase from rat
PDB Compounds: (A:) calcium/calmodulin-dependent protein kinase

SCOPe Domain Sequences for d1a06a_:

Sequence, based on SEQRES records: (download)

>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
wkqaedirdiydfrdvlgtgafsevilaedkrtqklvaikciakkalegkegsmeneiav
lhkikhpnivalddiyesgghlylimqlvsggelfdrivekgfyterdasrlifqvldav
kylhdlgivhrdlkpenllyysldedskimisdfglskmedpgsvlstacgtpgyvapev
laqkpyskavdcwsigviayillcgyppfydendaklfeqilkaeyefdspywddisdsa
kdfirhlmekdpekrftceqalqhpwiagdtaldknihqsvseqikknfakskwkqafna
tavvrhm

Sequence, based on observed residues (ATOM records): (download)

>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
wkqaedirdiydfrdvlgtgafsevilaedkrtqklvaikciakeneiavlhkikhpniv
alddiyesgghlylimqlvsggelfdrivekgfyterdasrlifqvldavkylhdlgivh
rdlkpenllyysldedskimisdfpgyvapevlaqkpyskavdcwsigviayillcgypp
fydendaklfeqilkaeyefdspywddisdsakdfirhlmekdpekrftceqalqhpwia
gdtaldknihqsvseqikknfakskwkqafnatavvrhm

SCOPe Domain Coordinates for d1a06a_:

Click to download the PDB-style file with coordinates for d1a06a_.
(The format of our PDB-style files is described here.)

Timeline for d1a06a_: