Lineage for d1apme_ (1apm E:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36270Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins)
  6. 36277Protein cAMP-dependent PK, catalytic subunit [56116] (3 species)
  7. 36283Species Mouse (Mus musculus) [TaxId:10090] [56119] (6 PDB entries)
  8. 36284Domain d1apme_: 1apm E: [41628]

Details for d1apme_

PDB Entry: 1apm (more details), 2 Å

PDB Description: 2.0 angstrom refined crystal structure of the catalytic subunit of camp-dependent protein kinase complexed with a peptide inhibitor and detergent

SCOP Domain Sequences for d1apme_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apme_ d.144.1.1 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus)}
seqesvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlvkhkesgnhy
amkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggemf
shlrrigrfaepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfak
rvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyek
ivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrk
veapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef

SCOP Domain Coordinates for d1apme_:

Click to download the PDB-style file with coordinates for d1apme_.
(The format of our PDB-style files is described here.)

Timeline for d1apme_: