SCOP 1.63: Domain d1stce_: 1stc E:

Lineage for d1stce_ (1stc E:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.1: Serine/threonin kinases [56113] (21 proteins)

6. Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56118] (4 PDB entries)

8. Domain d1stce_: 1stc E: [41627]
   complexed with sto

Details for d1stce_

PDB Entry: 1stc, 2.3 Å

PDB Description: camp-dependent protein kinase, alpha-catalytic subunit in complex with staurosporine

SCOP Domain Sequences for d1stce_:

Sequence; same for both SEQRES and ATOM records:

>d1stce_ d.144.1.1 (E:) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus)}
vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil
dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
vrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapf
ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

Timeline for d1stce_:

• d1stce_ first appeared (with stable ids) in SCOP 1.55
  
• d1stce_ appears in SCOP 1.61
  
• d1stce_ appears in SCOP 1.65
  
• d1stce_ appears in the current release, SCOPe 2.08