Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins) members organized in the groups and subfamiles specified by the comments |
Protein cAMP-dependent PK, catalytic subunit [56116] (4 species) AGC group; PKA subfamily; serine/threonine kinase |
Species Cow (Bos taurus) [TaxId:9913] [56118] (32 PDB entries) Uniprot P00517 |
Domain d1ydte_: 1ydt E: [41626] complexed with iqb |
PDB Entry: 1ydt (more details), 2.3 Å
SCOP Domain Sequences for d1ydte_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ydte_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]} vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggemfshlrr igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk vrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfattdwiaiyqrkveapf ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
Timeline for d1ydte_: