Lineage for d1ctpe_ (1ctp E:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36270Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins)
  6. 36277Protein cAMP-dependent PK, catalytic subunit [56116] (3 species)
  7. 36290Species Pig (Sus scrofa) [TaxId:9823] [56117] (3 PDB entries)
  8. 36293Domain d1ctpe_: 1ctp E: [41622]

Details for d1ctpe_

PDB Entry: 1ctp (more details), 2.9 Å

PDB Description: structure of the mammalian catalytic subunit of camp-dependent protein kinase and an inhibitor peptide displays an open conformation

SCOP Domain Sequences for d1ctpe_:

Sequence, based on SEQRES records: (download)

>d1ctpe_ d.144.1.1 (E:) cAMP-dependent PK, catalytic subunit {Pig (Sus scrofa)}
kkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhketg
nhfamkildkqkvvklkqiehtlnekrilqavnfpflvkleysfkdnsnlymvmeyvpgg
emfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfg
fakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqi
yekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiy
qrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

Sequence, based on observed residues (ATOM records): (download)

>d1ctpe_ d.144.1.1 (E:) cAMP-dependent PK, catalytic subunit {Pig (Sus scrofa)}
kkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhketg
nhfamkildkqkvvklkqiehtlnekrilqavnfpflvkleysfkdnsnlymvmeyvpgg
emfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfg
fakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqi
yekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiy
qrkveapfipkfddyeeeeirvsekcgkefsef

SCOP Domain Coordinates for d1ctpe_:

Click to download the PDB-style file with coordinates for d1ctpe_.
(The format of our PDB-style files is described here.)

Timeline for d1ctpe_: