Lineage for d1cdkb_ (1cdk B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734803Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 734856Species Pig (Sus scrofa) [TaxId:9823] [56117] (3 PDB entries)
  8. 734858Domain d1cdkb_: 1cdk B: [41621]
    complexed with anp, mn, myr, po3

Details for d1cdkb_

PDB Entry: 1cdk (more details), 2 Å

PDB Description: camp-dependent protein kinase catalytic subunit (e.c.2.7.1.37) (protein kinase a) complexed with protein kinase inhibitor peptide fragment 5-24 (pki(5-24) isoelectric variant ca) and mn2+ adenylyl imidodiphosphate (mnamp-pnp) at ph 5.6 and 7c and 4c
PDB Compounds: (B:) cAMP-DEPENDENT PROTEIN KINASE

SCOP Domain Sequences for d1cdkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdkb_ d.144.1.7 (B:) cAMP-dependent PK, catalytic subunit {Pig (Sus scrofa) [TaxId: 9823]}
kgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhketgn
hfamkildkqkvvklkqiehtlnekrilqavnfpflvkleysfkdnsnlymvmeyvpgge
mfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgf
akrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiy
ekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfattdwiaiyq
rkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOP Domain Coordinates for d1cdkb_:

Click to download the PDB-style file with coordinates for d1cdkb_.
(The format of our PDB-style files is described here.)

Timeline for d1cdkb_: