Lineage for d1cdkb_ (1cdk B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36270Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins)
  6. 36277Protein cAMP-dependent PK, catalytic subunit [56116] (3 species)
  7. 36290Species Pig (Sus scrofa) [TaxId:9823] [56117] (3 PDB entries)
  8. 36292Domain d1cdkb_: 1cdk B: [41621]

Details for d1cdkb_

PDB Entry: 1cdk (more details), 2 Å

PDB Description: camp-dependent protein kinase catalytic subunit (e.c.2.7.1.37) (protein kinase a) complexed with protein kinase inhibitor peptide fragment 5-24 (pki(5-24) isoelectric variant ca) and mn2+ adenylyl imidodiphosphate (mnamp-pnp) at ph 5.6 and 7c and 4c

SCOP Domain Sequences for d1cdkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdkb_ d.144.1.1 (B:) cAMP-dependent PK, catalytic subunit {Pig (Sus scrofa)}
kgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhketgn
hfamkildkqkvvklkqiehtlnekrilqavnfpflvkleysfkdnsnlymvmeyvpgge
mfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgf
akrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiy
ekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfattdwiaiyq
rkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOP Domain Coordinates for d1cdkb_:

Click to download the PDB-style file with coordinates for d1cdkb_.
(The format of our PDB-style files is described here.)

Timeline for d1cdkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cdka_