Lineage for d1bi8c_ (1bi8 C:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874749Protein Cyclin-dependent PK, CDK6 [88859] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 874750Species Human (Homo sapiens) [TaxId:9606] [88860] (8 PDB entries)
  8. 874758Domain d1bi8c_: 1bi8 C: [41618]
    Other proteins in same PDB: d1bi8b_, d1bi8d_

Details for d1bi8c_

PDB Entry: 1bi8 (more details), 2.8 Å

PDB Description: mechanism of g1 cyclin dependent kinase inhibition from the structures cdk6-p19ink4d inhibitor complex
PDB Compounds: (C:) cyclin-dependent kinase 6

SCOP Domain Sequences for d1bi8c_:

Sequence, based on SEQRES records: (download)

>d1bi8c_ d.144.1.7 (C:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
qqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhlet
fehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfqll
rgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrapev
llqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdvalp
rqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfq

Sequence, based on observed residues (ATOM records): (download)

>d1bi8c_ d.144.1.7 (C:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
qqyecvaeigegaygkvfkardlknggrfvalkrvrvqehpnvvrlfdvctvsrtkltlv
fehvdqdlttyldkvpepgvptetikdmmfqllrgldflhshrvvhrdlkpqnilvtssg
qikladfglariysfqmaltsvvvtlwyrapevllqssyatpvdlwsvgcifaemfrrkp
lfrgssdvdqlgkildviglpgeedwprdvalprqafhsksaqpiekfvtdidelgkdll
lkcltfnpakrisaysalshpyfq

SCOP Domain Coordinates for d1bi8c_:

Click to download the PDB-style file with coordinates for d1bi8c_.
(The format of our PDB-style files is described here.)

Timeline for d1bi8c_: