Lineage for d1bi8c_ (1bi8 C:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138043Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 138044Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 138045Family d.144.1.1: Serine/threonin kinases [56113] (17 proteins)
  6. 138088Protein Cyclin-dependent PK (CDK, different isozymes) [56114] (1 species)
  7. 138089Species Human (Homo sapiens) [TaxId:9606] [56115] (31 PDB entries)
  8. 138125Domain d1bi8c_: 1bi8 C: [41618]
    Other proteins in same PDB: d1bi8b_, d1bi8d_

Details for d1bi8c_

PDB Entry: 1bi8 (more details), 2.8 Å

PDB Description: mechanism of g1 cyclin dependent kinase inhibition from the structures cdk6-p19ink4d inhibitor complex

SCOP Domain Sequences for d1bi8c_:

Sequence, based on SEQRES records: (download)

>d1bi8c_ d.144.1.1 (C:) Cyclin-dependent PK (CDK, different isozymes) {Human (Homo sapiens)}
qqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhlet
fehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfqll
rgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrapev
llqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdvalp
rqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfq

Sequence, based on observed residues (ATOM records): (download)

>d1bi8c_ d.144.1.1 (C:) Cyclin-dependent PK (CDK, different isozymes) {Human (Homo sapiens)}
qqyecvaeigegaygkvfkardlknggrfvalkrvrvqehpnvvrlfdvctvsrtkltlv
fehvdqdlttyldkvpepgvptetikdmmfqllrgldflhshrvvhrdlkpqnilvtssg
qikladfglariysfqmaltsvvvtlwyrapevllqssyatpvdlwsvgcifaemfrrkp
lfrgssdvdqlgkildviglpgeedwprdvalprqafhsksaqpiekfvtdidelgkdll
lkcltfnpakrisaysalshpyfq

SCOP Domain Coordinates for d1bi8c_:

Click to download the PDB-style file with coordinates for d1bi8c_.
(The format of our PDB-style files is described here.)

Timeline for d1bi8c_: