Lineage for d1g3na_ (1g3n A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36270Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins)
  6. 36304Protein Cyclin-dependent PK (CDK, different isozymes) [56114] (1 species)
  7. 36305Species Human (Homo sapiens) [TaxId:9606] [56115] (20 PDB entries)
  8. 36326Domain d1g3na_: 1g3n A: [41613]
    Other proteins in same PDB: d1g3nb_, d1g3nc1, d1g3nc2, d1g3nf_, d1g3ng1, d1g3ng2

Details for d1g3na_

PDB Entry: 1g3n (more details), 2.9 Å

PDB Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex

SCOP Domain Sequences for d1g3na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3na_ d.144.1.1 (A:) Cyclin-dependent PK (CDK, different isozymes) {Human (Homo sapiens)}
adqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhl
etfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfq
llrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrap
evllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdva
lprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfq

SCOP Domain Coordinates for d1g3na_:

Click to download the PDB-style file with coordinates for d1g3na_.
(The format of our PDB-style files is described here.)

Timeline for d1g3na_: