Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) |
Family d.144.1.1: Serine/threonin kinases [56113] (16 proteins) |
Protein Cyclin-dependent PK (CDK, different isozymes) [56114] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [56115] (24 PDB entries) |
Domain d1jsta_: 1jst A: [41609] Other proteins in same PDB: d1jstb1, d1jstb2, d1jstd1, d1jstd2 |
PDB Entry: 1jst (more details), 2.6 Å
SCOP Domain Sequences for d1jsta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jsta_ d.144.1.1 (A:) Cyclin-dependent PK (CDK, different isozymes) {Human (Homo sapiens)} menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh pnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchs hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl
Timeline for d1jsta_: