Lineage for d1cko_2 (1cko 11-238)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262579Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 262754Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (3 families) (S)
    has a circularly permuted topology
  5. 262771Family d.142.2.3: RNA guanylyltransferase (mRNA capping enzyme), N-terminal domain [56100] (1 protein)
  6. 262772Protein RNA guanylyltransferase (mRNA capping enzyme), N-terminal domain [56101] (1 species)
  7. 262773Species Chlorella virus, PBCV-1 [56102] (3 PDB entries)
  8. 262778Domain d1cko_2: 1cko 11-238 [41589]
    Other proteins in same PDB: d1cko_1
    complexed with gp3, zn

Details for d1cko_2

PDB Entry: 1cko (more details), 3.1 Å

PDB Description: structure of mrna capping enzyme in complex with the cap analog gpppg

SCOP Domain Sequences for d1cko_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cko_2 d.142.2.3 (11-238) RNA guanylyltransferase (mRNA capping enzyme), N-terminal domain {Chlorella virus, PBCV-1}
nitteravltlnglqiklhkvvgesrddivakmkdlamddhkfprlpgpnpvsierkdfe
klkqnkyvvsektdgirfmmfftrvfgfkvctiidramtvyllpfkniprvlfqgsifdg
elcvdivekkfafvlfdavvvsgvtvsqmdlasrffamkrslkefknvpedpailrykew
iplehptiikdhlkkanaiyhtdgliimsvdepviygrnfnlfklkpg

SCOP Domain Coordinates for d1cko_2:

Click to download the PDB-style file with coordinates for d1cko_2.
(The format of our PDB-style files is described here.)

Timeline for d1cko_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cko_1