![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) ![]() has a circularly permuted topology |
![]() | Family d.142.2.3: mRNA capping enzyme [56100] (2 proteins) automatically mapped to Pfam PF01331 |
![]() | Protein RNA guanylyltransferase (mRNA capping enzyme), N-terminal domain [56101] (1 species) |
![]() | Species Chlorella virus PBCV-1 [TaxId:10506] [56102] (3 PDB entries) |
![]() | Domain d1ckoa2: 1cko A:11-238 [41589] Other proteins in same PDB: d1ckoa1 protein/RNA complex; complexed with gp3, zn |
PDB Entry: 1cko (more details), 3.1 Å
SCOPe Domain Sequences for d1ckoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ckoa2 d.142.2.3 (A:11-238) RNA guanylyltransferase (mRNA capping enzyme), N-terminal domain {Chlorella virus PBCV-1 [TaxId: 10506]} nitteravltlnglqiklhkvvgesrddivakmkdlamddhkfprlpgpnpvsierkdfe klkqnkyvvsektdgirfmmfftrvfgfkvctiidramtvyllpfkniprvlfqgsifdg elcvdivekkfafvlfdavvvsgvtvsqmdlasrffamkrslkefknvpedpailrykew iplehptiikdhlkkanaiyhtdgliimsvdepviygrnfnlfklkpg
Timeline for d1ckoa2: