Lineage for d1dgtb4 (1dgt B:2001-2314)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334707Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 334888Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (3 families) (S)
    has a circularly permuted topology
  5. 334895Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (1 protein)
  6. 334896Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (2 species)
    contains additional, N-terminal all-alpha subdomain
  7. 334900Species Thermus filiformis [TaxId:276] [56099] (2 PDB entries)
  8. 334904Domain d1dgtb4: 1dgt B:2001-2314 [41584]
    Other proteins in same PDB: d1dgta1, d1dgta2, d1dgtb1, d1dgtb2, d1dgtb3
    complexed with amp, zn

Details for d1dgtb4

PDB Entry: 1dgt (more details), 2.9 Å

PDB Description: crystal structure of nad+-dependent dna ligase

SCOP Domain Sequences for d1dgtb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgtb4 d.142.2.2 (B:2001-2314) Adenylation domain of NAD+-dependent DNA ligase {Thermus filiformis}
mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
teqvgarpleptfrpvrhptrmysldnaftyeevlafeerlereaeapslytvehkvdgl
svlyyeegvwstgsgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympieaflrl
neeleergekvfknprnaaagslrqkdprvtakrglratfyalglglgleesglksqyel
llwlkekgfpvehcyekalgaegveevyrrglaqrhalpfeadgvvlklddltlwgelgy
taraprfalaykfp

SCOP Domain Coordinates for d1dgtb4:

Click to download the PDB-style file with coordinates for d1dgtb4.
(The format of our PDB-style files is described here.)

Timeline for d1dgtb4: