| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (5 families) ![]() has a circularly permuted topology |
| Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins) automatically mapped to Pfam PF01653 |
| Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (4 species) contains additional, N-terminal all-alpha subdomain |
| Species Thermus filiformis [TaxId:276] [56099] (2 PDB entries) |
| Domain d1dgsb3: 1dgs B:2001-2314 [41582] Other proteins in same PDB: d1dgsa1, d1dgsa2, d1dgsb1, d1dgsb2 protein/DNA complex; complexed with amp, zn |
PDB Entry: 1dgs (more details), 2.9 Å
SCOPe Domain Sequences for d1dgsb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dgsb3 d.142.2.2 (B:2001-2314) Adenylation domain of NAD+-dependent DNA ligase {Thermus filiformis [TaxId: 276]}
mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
teqvgarpleptfrpvrhptrmysldnaftyeevlafeerlereaeapslytvehkvdgl
svlyyeegvwstgsgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympieaflrl
neeleergekvfknprnaaagslrqkdprvtakrglratfyalglglgleesglksqyel
llwlkekgfpvehcyekalgaegveevyrrglaqrhalpfeadgvvlklddltlwgelgy
taraprfalaykfp
Timeline for d1dgsb3: