Lineage for d1dgsb3 (1dgs B:2001-2314)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219586Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1219875Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (4 families) (S)
    has a circularly permuted topology
  5. 1219891Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins)
  6. 1219892Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (4 species)
    contains additional, N-terminal all-alpha subdomain
  7. 1219910Species Thermus filiformis [TaxId:276] [56099] (2 PDB entries)
  8. 1219912Domain d1dgsb3: 1dgs B:2001-2314 [41582]
    Other proteins in same PDB: d1dgsa1, d1dgsa2, d1dgsb1, d1dgsb2
    protein/DNA complex; complexed with amp, zn

Details for d1dgsb3

PDB Entry: 1dgs (more details), 2.9 Å

PDB Description: crystal structure of nad+-dependent dna ligase from t. filiformis
PDB Compounds: (B:) DNA ligase

SCOPe Domain Sequences for d1dgsb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgsb3 d.142.2.2 (B:2001-2314) Adenylation domain of NAD+-dependent DNA ligase {Thermus filiformis [TaxId: 276]}
mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
teqvgarpleptfrpvrhptrmysldnaftyeevlafeerlereaeapslytvehkvdgl
svlyyeegvwstgsgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympieaflrl
neeleergekvfknprnaaagslrqkdprvtakrglratfyalglglgleesglksqyel
llwlkekgfpvehcyekalgaegveevyrrglaqrhalpfeadgvvlklddltlwgelgy
taraprfalaykfp

SCOPe Domain Coordinates for d1dgsb3:

Click to download the PDB-style file with coordinates for d1dgsb3.
(The format of our PDB-style files is described here.)

Timeline for d1dgsb3: