![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) ![]() has a circularly permuted topology |
![]() | Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins) automatically mapped to Pfam PF01653 |
![]() | Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (4 species) contains additional, N-terminal all-alpha subdomain |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [56098] (1 PDB entry) |
![]() | Domain d1b04a_: 1b04 A: [41579] |
PDB Entry: 1b04 (more details), 2.8 Å
SCOPe Domain Sequences for d1b04a_:
Sequence, based on SEQRES records: (download)
>d1b04a_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Bacillus stearothermophilus [TaxId: 1422]} drqqaerraaelrellnrygyeyyvldrpsvpdaeydrlmqeliaieeqypelktsdspt qriggppleafrkvahrvpmmslanafgegdlrdfdrrvrqevgeaayvcelaidglavs vryedgyfvqgatrgdgttgeditenlktirslplrlkepvsleargeafmpkasflrln eerkargeelfanprnaaagslrqldpkvaasrqldlfvygladaealgiashsealdyl qalgfkvnperrrcanideviafvsewhdkrpqlpyeidgivikvdsfaqqralgataks prwaiaykfpae
>d1b04a_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Bacillus stearothermophilus [TaxId: 1422]} drqqaerraaelrellnrygyeyyvldrpsvpdaeydrlmqeliaieeqypelktsdspt qriggppleafrkvahrvpmmslanafgegdlrdfdrrvrqevgeaayvcelaidglavs vryedgyfvqgatrgdgttgeditenlktirslplrlkepvsleargeafmpkasflrln eerkarelfanprnaaagslrqldpkvaasrqldlfvygladaealgiashsealdylqa lgfkvnperrrcanideviafvsewhdkrpqlpyeidgivikvdsfaqqralgatakspr waiaykfpae
Timeline for d1b04a_: