Lineage for d1fvia2 (1fvi A:2-189)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262579Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 262754Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (3 families) (S)
    has a circularly permuted topology
  5. 262755Family d.142.2.1: ATP-dependent DNA ligase, N-terminal domain [56092] (1 protein)
  6. 262756Protein ATP-dependent DNA ligase, N-terminal domain [56093] (2 species)
  7. 262759Species Chlorella virus, PBCV-1 [56095] (1 PDB entry)
  8. 262760Domain d1fvia2: 1fvi A:2-189 [41578]
    Other proteins in same PDB: d1fvia1
    complexed with amp, so4; mutant

Details for d1fvia2

PDB Entry: 1fvi (more details), 2 Å

PDB Description: crystal structure of chlorella virus dna ligase-adenylate

SCOP Domain Sequences for d1fvia2:

Sequence, based on SEQRES records: (download)

>d1fvia2 d.142.2.1 (A:2-189) ATP-dependent DNA ligase, N-terminal domain {Chlorella virus, PBCV-1}
aitkpllaatleniedvqfpclatpkiagirsvkqtqmlsrtfkpirnsvmnrlltellp
egsdgeisiegatfqdttsavmtghkmynakfsyywfdyvtddplkkyidrvedmknyit
vhphilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlke
gillkmkq

Sequence, based on observed residues (ATOM records): (download)

>d1fvia2 d.142.2.1 (A:2-189) ATP-dependent DNA ligase, N-terminal domain {Chlorella virus, PBCV-1}
aitkpllaatleniedvqfpclatpkiagirsvkqtqmlsrtfkpirnsvmnrlltellp
egsdgeisiegatfqdttsavmtghakfsyywfdyvtddplkkyidrvedmknyitvhph
ilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlkegill
kmkq

SCOP Domain Coordinates for d1fvia2:

Click to download the PDB-style file with coordinates for d1fvia2.
(The format of our PDB-style files is described here.)

Timeline for d1fvia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fvia1