Lineage for d1a0i_2 (1a0i 2-240)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334707Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 334888Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (3 families) (S)
    has a circularly permuted topology
  5. 334889Family d.142.2.1: ATP-dependent DNA ligase, N-terminal domain [56092] (1 protein)
  6. 334890Protein ATP-dependent DNA ligase, N-terminal domain [56093] (2 species)
  7. 334891Species Bacteriophage T7 [TaxId:10760] [56094] (1 PDB entry)
  8. 334892Domain d1a0i_2: 1a0i 2-240 [41577]
    Other proteins in same PDB: d1a0i_1
    complexed with atp; mutant

Details for d1a0i_2

PDB Entry: 1a0i (more details), 2.6 Å

PDB Description: atp-dependent dna ligase from bacteriophage t7 complex with atp

SCOP Domain Sequences for d1a0i_2:

Sequence, based on SEQRES records: (download)

>d1a0i_2 d.142.2.1 (2-240) ATP-dependent DNA ligase, N-terminal domain {Bacteriophage T7}
vniktnpfkavsfvesaikkaldnagyliaeikydgvrgnicvdntansywlsrvsktip
alehlngfdvrwkrllnddrcfykdgfmldgelmvkgvdfntgsgllrtkwtdtknqefh
eelfvepirkkdkvpfklhtghlhiklyailplhivesgedcdvmtllmqehvknmlpll
qeyfpeiewqaaesyevydmvelqqlyeqkraegheglivkdpmciykrgkksgwwkmk

Sequence, based on observed residues (ATOM records): (download)

>d1a0i_2 d.142.2.1 (2-240) ATP-dependent DNA ligase, N-terminal domain {Bacteriophage T7}
vniktnpfkavsfvesaikkaldnagyliaeikydgvrgnicvdntansywlsrvsktip
alehlngfdvrwkrllnddrcfykdgfmldgelmvkgvdfntgsgllrtkwtdtknqefh
rkkdkvpfklhtghlhiklyailplhivesgedcdvmtllmqehvknmlpllqeyfpeie
wqaaesyevydmvelqqlyeqkraegheglivkdpmciykrgkksgwwkmk

SCOP Domain Coordinates for d1a0i_2:

Click to download the PDB-style file with coordinates for d1a0i_2.
(The format of our PDB-style files is described here.)

Timeline for d1a0i_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a0i_1