Lineage for d1dik_3 (1dik 2-376)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611545Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 611546Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (7 families) (S)
  5. 611736Family d.142.1.5: Pyruvate phosphate dikinase, N-terminal domain [56085] (1 protein)
  6. 611737Protein Pyruvate phosphate dikinase, N-terminal domain [56086] (2 species)
    the common fold is interrupted by a 4-helical subdomain (residues 112-198)
  7. 611738Species Clostridium symbiosum [TaxId:1512] [56087] (6 PDB entries)
  8. 611741Domain d1dik_3: 1dik 2-376 [41572]
    Other proteins in same PDB: d1dik_1, d1dik_2
    CASP1
    complexed with so4

Details for d1dik_3

PDB Entry: 1dik (more details), 2.3 Å

PDB Description: pyruvate phosphate dikinase

SCOP Domain Sequences for d1dik_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dik_3 d.142.1.5 (2-376) Pyruvate phosphate dikinase, N-terminal domain {Clostridium symbiosum}
akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei
qdqifeaitwleelngkkfgdtedpllvsvrsaarasmpgmmdtilnlglndvavegfak
ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite
eeavvrieaksldql

SCOP Domain Coordinates for d1dik_3:

Click to download the PDB-style file with coordinates for d1dik_3.
(The format of our PDB-style files is described here.)

Timeline for d1dik_3: