Lineage for d6bjwa1 (6bjw A:1-190)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775209Species Eubacterium eligens [TaxId:515620] [420002] (3 PDB entries)
  8. 2775212Domain d6bjwa1: 6bjw A:1-190 [415701]
    Other proteins in same PDB: d6bjwa2, d6bjwa3
    automated match to d6u7ia1

Details for d6bjwa1

PDB Entry: 6bjw (more details), 3 Å

PDB Description: eubacterium eligens beta-glucuronidase
PDB Compounds: (A:) Glycoside Hydrolase Family 2 candidate b-glucuronidase

SCOPe Domain Sequences for d6bjwa1:

Sequence, based on SEQRES records: (download)

>d6bjwa1 b.18.1.0 (A:1-190) automated matches {Eubacterium eligens [TaxId: 515620]}
mlypvltqsrllsdlsgvwdfkldngkgfeekwyekplkdadtmpvpasyndlkegtdfr
dhygwvfyqrnisvpeyvksqrivlrcaavthyamiylngklicehkggflpfevelndd
lqdgdnlltiavnnvidyttlpvggkanmmsgmmggmgagasdkpqnnpnfdffnycgit
rpvkiyttpe

Sequence, based on observed residues (ATOM records): (download)

>d6bjwa1 b.18.1.0 (A:1-190) automated matches {Eubacterium eligens [TaxId: 515620]}
mlypvltqsrllsdlsgvwdfkldngkgfeekwyekplkdadtmpvpasyndlkegtdfr
dhygwvfyqrnisvksqrivlrcaavthyamiylngklicehkggflpfevelnddlqdg
dnlltiavnnvidyttlpvggkanmmsgagasdkpqnnpnfdffnycgitrpvkiyttpe

SCOPe Domain Coordinates for d6bjwa1:

Click to download the PDB-style file with coordinates for d6bjwa1.
(The format of our PDB-style files is described here.)

Timeline for d6bjwa1:

  • d6bjwa1 is new in SCOPe 2.08-stable