SCOPe 2.04: Domain d1cqie2: 1cqi E:1-238

Lineage for d1cqie2 (1cqi E:1-238)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)

5. Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
   automatically mapped to Pfam PF13549
   automatically mapped to Pfam PF08442

6. Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)

7. Species Escherichia coli [TaxId:562] [56083] (11 PDB entries)

8. Domain d1cqie2: 1cqi E:1-238 [41569]
   Other proteins in same PDB: d1cqia1, d1cqia2, d1cqib1, d1cqid1, d1cqid2, d1cqie1
   complexed with adp, coa, mg, po4

Details for d1cqie2

PDB Entry: 1cqi, 3.3 Å

PDB Description: crystal structure of the complex of adp and mg2+ with dephosphorylated e. coli succinyl-coa synthetase

PDB Compounds: (E:) protein (succinyl-coa synthetase beta chain)

SCOPe Domain Sequences for d1cqie2:

Sequence; same for both SEQRES and ATOM records:

>d1cqie2 d.142.1.4 (E:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

Timeline for d1cqie2:

• d1cqie2 first appeared (with stable ids) in SCOP 1.55
  
• d1cqie2 appears in SCOPe 2.03
  
• d1cqie2 appears in SCOPe 2.05
  
• d1cqie2 appears in the current release, SCOPe 2.08