Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein) automatically mapped to Pfam PF13549 automatically mapped to Pfam PF08442 |
Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species) |
Species Escherichia coli [TaxId:562] [56083] (11 PDB entries) |
Domain d1cqib2: 1cqi B:1-238 [41568] Other proteins in same PDB: d1cqia1, d1cqia2, d1cqib1, d1cqid1, d1cqid2, d1cqie1 complexed with adp, coa, mg, po4 |
PDB Entry: 1cqi (more details), 3.3 Å
SCOPe Domain Sequences for d1cqib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqib2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]} mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe
Timeline for d1cqib2: