SCOP 1.59: Domain d1scue2: 1scu E:1-238

Lineage for d1scue2 (1scu E:1-238)

Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
Fold d.142: ATP-grasp [56058] (2 superfamilies)
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families)
Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)
Species Escherichia coli [TaxId:562] [56083] (6 PDB entries)
Domain d1scue2: 1scu E:1-238 [41567]
Other proteins in same PDB: d1scua1, d1scua2, d1scub1, d1scud1, d1scud2, d1scue1

Details for d1scue2

PDB Entry: 1scu (more details), 2.5 Å

PDB Description: the crystal structure of succinyl-coa synthetase from escherichia coli at 2.5 angstroms resolution

SCOP Domain Sequences for d1scue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scue2 d.142.1.4 (E:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

SCOP Domain Coordinates for d1scue2:

Click to download the PDB-style file with coordinates for d1scue2.
(The format of our PDB-style files is described here.)

Timeline for d1scue2: