Lineage for d2scub2 (2scu B:1-238)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84221Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 84222Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 84332Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
  6. 84333Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)
  7. 84334Species Escherichia coli [TaxId:562] [56083] (4 PDB entries)
  8. 84335Domain d2scub2: 2scu B:1-238 [41562]
    Other proteins in same PDB: d2scua1, d2scua2, d2scub1, d2scud1, d2scud2, d2scue1

Details for d2scub2

PDB Entry: 2scu (more details), 2.3 Å

PDB Description: A detailed description of the structure of Succinyl-COA synthetase from Escherichia coli

SCOP Domain Sequences for d2scub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2scub2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

SCOP Domain Coordinates for d2scub2:

Click to download the PDB-style file with coordinates for d2scub2.
(The format of our PDB-style files is described here.)

Timeline for d2scub2: