Lineage for d1auxb2 (1aux B:214-417)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873884Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 873885Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families) (S)
  5. 874047Family d.142.1.3: Synapsin C-terminal domain [56078] (2 proteins)
  6. 874048Protein Synapsin [56079] (2 species)
  7. 874049Species Cow (Bos taurus) [TaxId:9913] [56080] (2 PDB entries)
  8. 874053Domain d1auxb2: 1aux B:214-417 [41561]
    Other proteins in same PDB: d1auxa1, d1auxb1
    complexed with ca, sap

Details for d1auxb2

PDB Entry: 1aux (more details), 2.3 Å

PDB Description: structure of the c domain of synapsin ia from bovine brain with calcium atp-gamma-s bound
PDB Compounds: (B:) synapsin ia

SCOP Domain Sequences for d1auxb2:

Sequence, based on SEQRES records: (download)

>d1auxb2 d.142.1.3 (B:214-417) Synapsin {Cow (Bos taurus) [TaxId: 9913]}
nslhsvynfcdkpwvfaqmvrlhkklgteefplinqtfypnhkemlssttypvvvkmgha
hsgmgkvkvdnqhdfqdiasvvaltktyattepfidakydvriqkigqnykaymrtsvsg
nwktntgsamleqiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmp
ligdhqdedkqlivelvvnkmaqa

Sequence, based on observed residues (ATOM records): (download)

>d1auxb2 d.142.1.3 (B:214-417) Synapsin {Cow (Bos taurus) [TaxId: 9913]}
nslhsvynfcdkpwvfaqmvrlhkklgteefplinqtfypnhkemlssttypvvvkmgha
hsgmgkvkvdnqhdfqdiasvvaltktyattepfidakydvriqkigqnykaymrtleqi
amsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqliv
elvvnkmaqa

SCOP Domain Coordinates for d1auxb2:

Click to download the PDB-style file with coordinates for d1auxb2.
(The format of our PDB-style files is described here.)

Timeline for d1auxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1auxb1