Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.3: Synapsin C-terminal domain [56078] (3 proteins) automatically mapped to Pfam PF02750 |
Protein Synapsin [56079] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [56080] (2 PDB entries) |
Domain d1auxa2: 1aux A:214-417 [41560] Other proteins in same PDB: d1auxa1, d1auxb1 complexed with ags, ca |
PDB Entry: 1aux (more details), 2.3 Å
SCOPe Domain Sequences for d1auxa2:
Sequence, based on SEQRES records: (download)
>d1auxa2 d.142.1.3 (A:214-417) Synapsin {Cow (Bos taurus) [TaxId: 9913]} nslhsvynfcdkpwvfaqmvrlhkklgteefplinqtfypnhkemlssttypvvvkmgha hsgmgkvkvdnqhdfqdiasvvaltktyattepfidakydvriqkigqnykaymrtsvsg nwktntgsamleqiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmp ligdhqdedkqlivelvvnkmaqa
>d1auxa2 d.142.1.3 (A:214-417) Synapsin {Cow (Bos taurus) [TaxId: 9913]} nslhsvynfcdkpwvfaqmvrlhkklgteefplinqtfypnhkemlssttypvvvkmgha hsgmgkvkvdnqhdfqdiasvvaltktyattepfidakydvriqkigqnykaymrtleqi amsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqliv elvvnkmaqa
Timeline for d1auxa2: