SCOP 1.75: Domain d1auva2: 1auv A:214-417

Lineage for d1auva2 (1auv A:214-417)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families)

5. Family d.142.1.3: Synapsin C-terminal domain [56078] (2 proteins)

6. Protein Synapsin [56079] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56080] (2 PDB entries)

8. Domain d1auva2: 1auv A:214-417 [41558]
   Other proteins in same PDB: d1auva1, d1auvb1

Details for d1auva2

PDB Entry: 1auv, 2.15 Å

PDB Description: structure of the c domain of synapsin ia from bovine brain

PDB Compounds: (A:) synapsin ia

SCOP Domain Sequences for d1auva2:

Sequence, based on SEQRES records:

>d1auva2 d.142.1.3 (A:214-417) Synapsin {Cow (Bos taurus) [TaxId: 9913]}
nslhsvynfcdkpwvfaqmvrlhkklgteefplinqtfypnhkemlssttypvvvkmgha
hsgmgkvkvdnqhdfqdiasvvaltktyattepfidakydvriqkigqnykaymrtsvsg
nwktntgsamleqiamsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmp
ligdhqdedkqlivelvvnkmaqa

Sequence, based on observed residues (ATOM records):

>d1auva2 d.142.1.3 (A:214-417) Synapsin {Cow (Bos taurus) [TaxId: 9913]}
nslhsvynfcdkpwvfaqmvrlhkklgteefplinqtfypnhkemlssttypvvvkmgha
hsgmgkvkvdnqhdfqdiasvvaltktyattepfidakydvriqkigqnykaymrtleqi
amsdryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqliv
elvvnkmaqa

Timeline for d1auva2:

• d1auva2 first appeared (with stable ids) in SCOP 1.55
  
• d1auva2 appears in SCOP 1.73
  
• d1auva2 appears in SCOPe 2.01
  
• d1auva2 appears in the current release, SCOPe 2.08