Lineage for d1bxrg5 (1bxr G:128-402)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611545Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 611546Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (7 families) (S)
  5. 611566Family d.142.1.2: BC ATP-binding domain-like [56067] (6 proteins)
  6. 611583Protein Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains [56076] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 611584Species Escherichia coli [TaxId:562] [56077] (10 PDB entries)
  8. 611655Domain d1bxrg5: 1bxr G:128-402 [41548]
    Other proteins in same PDB: d1bxra1, d1bxra2, d1bxra3, d1bxra4, d1bxrb1, d1bxrb2, d1bxrc1, d1bxrc2, d1bxrc3, d1bxrc4, d1bxrd1, d1bxrd2, d1bxre1, d1bxre2, d1bxre3, d1bxre4, d1bxrf1, d1bxrf2, d1bxrg1, d1bxrg2, d1bxrg3, d1bxrg4, d1bxrh1, d1bxrh2

Details for d1bxrg5

PDB Entry: 1bxr (more details), 2.1 Å

PDB Description: structure of carbamoyl phosphate synthetase complexed with the atp analog amppnp

SCOP Domain Sequences for d1bxrg5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxrg5 d.142.1.2 (G:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli}
drrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsgggiaynree
feeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdamgihtgds
itvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviemnprvsrs
salaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkiprfnfekf
agandrlttqmksvgevmaigrtqqeslqkalrgl

SCOP Domain Coordinates for d1bxrg5:

Click to download the PDB-style file with coordinates for d1bxrg5.
(The format of our PDB-style files is described here.)

Timeline for d1bxrg5: