Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (7 families) |
Family d.142.1.2: BC ATP-binding domain-like [56067] (5 proteins) |
Protein Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains [56076] (1 species) duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains |
Species Escherichia coli [TaxId:562] [56077] (9 PDB entries) |
Domain d1bxrg5: 1bxr G:128-402 [41548] Other proteins in same PDB: d1bxra1, d1bxra2, d1bxra3, d1bxra4, d1bxrb1, d1bxrb2, d1bxrc1, d1bxrc2, d1bxrc3, d1bxrc4, d1bxrd1, d1bxrd2, d1bxre1, d1bxre2, d1bxre3, d1bxre4, d1bxrf1, d1bxrf2, d1bxrg1, d1bxrg2, d1bxrg3, d1bxrg4, d1bxrh1, d1bxrh2 |
PDB Entry: 1bxr (more details), 2.1 Å
SCOP Domain Sequences for d1bxrg5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxrg5 d.142.1.2 (G:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli} drrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsgggiaynree feeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdamgihtgds itvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviemnprvsrs salaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkiprfnfekf agandrlttqmksvgevmaigrtqqeslqkalrgl
Timeline for d1bxrg5:
View in 3D Domains from other chains: (mouse over for more information) d1bxra1, d1bxra2, d1bxra3, d1bxra4, d1bxra5, d1bxra6, d1bxrb1, d1bxrb2, d1bxrc1, d1bxrc2, d1bxrc3, d1bxrc4, d1bxrc5, d1bxrc6, d1bxrd1, d1bxrd2, d1bxre1, d1bxre2, d1bxre3, d1bxre4, d1bxre5, d1bxre6, d1bxrf1, d1bxrf2, d1bxrh1, d1bxrh2 |