Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins) |
Protein Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains [56076] (1 species) duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains |
Species Escherichia coli [TaxId:562] [56077] (10 PDB entries) Uniprot P00968 |
Domain d1bxre6: 1bxr E:677-935 [41547] Other proteins in same PDB: d1bxra1, d1bxra2, d1bxra3, d1bxra4, d1bxrb1, d1bxrb2, d1bxrc1, d1bxrc2, d1bxrc3, d1bxrc4, d1bxrd1, d1bxrd2, d1bxre1, d1bxre2, d1bxre3, d1bxre4, d1bxrf1, d1bxrf2, d1bxrg1, d1bxrg2, d1bxrg3, d1bxrg4, d1bxrh1, d1bxrh2 complexed with anp, cl, k, mn, net, orn |
PDB Entry: 1bxr (more details), 2.1 Å
SCOPe Domain Sequences for d1bxre6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxre6 d.142.1.2 (E:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} rfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvlggrameivydeadlrr yfqtavsvsndapvlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacsl paytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvska tgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstge vmgvgrtfaeafakaqlgs
Timeline for d1bxre6:
View in 3D Domains from other chains: (mouse over for more information) d1bxra1, d1bxra2, d1bxra3, d1bxra4, d1bxra5, d1bxra6, d1bxrb1, d1bxrb2, d1bxrc1, d1bxrc2, d1bxrc3, d1bxrc4, d1bxrc5, d1bxrc6, d1bxrd1, d1bxrd2, d1bxrf1, d1bxrf2, d1bxrg1, d1bxrg2, d1bxrg3, d1bxrg4, d1bxrg5, d1bxrg6, d1bxrh1, d1bxrh2 |