Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) |
Family d.142.1.2: Biotin carboxylase/Carbamoyl phosphate synthetase [56067] (5 proteins) |
Protein Carbamoyl phosphate synthetase (CPS), large subunit [56076] (1 species) |
Species Escherichia coli [TaxId:562] [56077] (8 PDB entries) |
Domain d1bxra6: 1bxr A:677-935 [41543] Other proteins in same PDB: d1bxra1, d1bxra2, d1bxra3, d1bxra4, d1bxrb1, d1bxrb2, d1bxrc1, d1bxrc2, d1bxrc3, d1bxrc4, d1bxrd1, d1bxrd2, d1bxre1, d1bxre2, d1bxre3, d1bxre4, d1bxrf1, d1bxrf2, d1bxrg1, d1bxrg2, d1bxrg3, d1bxrg4, d1bxrh1, d1bxrh2 |
PDB Entry: 1bxr (more details), 2.1 Å
SCOP Domain Sequences for d1bxra6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxra6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli} rfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvlggrameivydeadlrr yfqtavsvsndapvlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacsl paytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvska tgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstge vmgvgrtfaeafakaqlgs
Timeline for d1bxra6:
View in 3D Domains from other chains: (mouse over for more information) d1bxrb1, d1bxrb2, d1bxrc1, d1bxrc2, d1bxrc3, d1bxrc4, d1bxrc5, d1bxrc6, d1bxrd1, d1bxrd2, d1bxre1, d1bxre2, d1bxre3, d1bxre4, d1bxre5, d1bxre6, d1bxrf1, d1bxrf2, d1bxrg1, d1bxrg2, d1bxrg3, d1bxrg4, d1bxrg5, d1bxrg6, d1bxrh1, d1bxrh2 |