Lineage for d1a9xg6 (1a9x G:6677-6935)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36099Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 36100Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 36117Family d.142.1.2: Biotin carboxylase/Carbamoyl phosphate synthetase [56067] (5 proteins)
  6. 36126Protein Carbamoyl phosphate synthetase (CPS), large subunit [56076] (1 species)
  7. 36127Species Escherichia coli [TaxId:562] [56077] (7 PDB entries)
  8. 36135Domain d1a9xg6: 1a9x G:6677-6935 [41509]
    Other proteins in same PDB: d1a9xa1, d1a9xa2, d1a9xa3, d1a9xa4, d1a9xb1, d1a9xb2, d1a9xc1, d1a9xc2, d1a9xc3, d1a9xc4, d1a9xd1, d1a9xd2, d1a9xe1, d1a9xe2, d1a9xe3, d1a9xe4, d1a9xf1, d1a9xf2, d1a9xg1, d1a9xg2, d1a9xg3, d1a9xg4, d1a9xh1, d1a9xh2

Details for d1a9xg6

PDB Entry: 1a9x (more details), 1.8 Å

PDB Description: carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis

SCOP Domain Sequences for d1a9xg6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9xg6 d.142.1.2 (G:6677-6935) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
rfqhaverlklkqpanatvtaiemavekakeigyplvvraameivydeadlrryfqtavl
ldhflddavevdvdaicdgemvliggimehieqagvhsgdsacslpaytlsqeiqdvmrq
qvqklafelqvrglmnvqfavknnevylievnpraartvpfvskatgvplakvaarvmag
kslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstgevmgvgrtfaeafaka
qlgs

SCOP Domain Coordinates for d1a9xg6:

Click to download the PDB-style file with coordinates for d1a9xg6.
(The format of our PDB-style files is described here.)

Timeline for d1a9xg6: