Lineage for d1gsoa3 (1gso A:104-327)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. Protein Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 [56070] (2 species)
  7. Species Escherichia coli [TaxId:562] [56071] (1 PDB entry)
  8. Domain d1gsoa3: 1gso A:104-327 [41492]
    Other proteins in same PDB: d1gsoa1, d1gsoa2

Details for d1gsoa3

PDB Entry: 1gso (more details), 1.6 Å

PDB Description: glycinamide ribonucleotide synthetase (gar-syn) from e. coli.
PDB Compounds: (A:) protein (glycinamide ribonucleotide synthetase)

SCOPe Domain Sequences for d1gsoa3:

Sequence, based on SEQRES records: (download)

>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]}
skaftkdflarhkiptaeyqnftevepalaylrekgapivikadglaagkgvivamtlee
aeaavhdmlagnafgdaghrivieefldgeeasfivmvdgehvlpmatsqdhkrvgdkdt
gpntggmgayspapvvtddvhqrtmeriiwptvkgmaaegntytgflyaglmidkqgnpk
viefncrfgdletqpimlrmksdlvelclaaceskldektsewd

Sequence, based on observed residues (ATOM records): (download)

>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]}
skaftkdflarhkiptaeyqnftevepalaylrekgapivikakgvivamtleeaeaavh
dmlagnafgdaghrivieefldgeeasfivmvdgehvlpmatsqdhkrvgdkdtgpntgg
mgayspapvvtddvhqrtmeriiwptvkgmaaegntytgflyaglmidkqgnpkviefnc
rfgdletqpimlrmksdlvelclaaceskldektsewd

SCOPe Domain Coordinates for d1gsoa3 are not available.

Timeline for d1gsoa3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsoa1, d1gsoa2