SCOP 1.57: Domain d1ffk12: 1ffk 1:80-172

Lineage for d1ffk12 (1ffk 1:80-172)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (2 species)

7. Species Haloarcula marismortui [TaxId:2238] [56057] (2 PDB entries)

8. Domain d1ffk12: 1ffk 1:80-172 [41476]
   Other proteins in same PDB: d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_

Details for d1ffk12

PDB Entry: 1ffk, 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffk12:

Sequence; same for both SEQRES and ATOM records:

>d1ffk12 d.141.1.1 (1:80-172) Ribosomal protein L6 {Haloarcula marismortui}
weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie
avgqtaadieqltrindkdvrvfqdgvyitrkp

Timeline for d1ffk12:

• d1ffk12 first appeared (with stable ids) in SCOP 1.55
  
• d1ffk12 appears in SCOP 1.59
  
• d1ffk12 appears in the current release, SCOPe 2.08