SCOP 1.65: Domain d1hnwh_: 1hnw H:

Lineage for d1hnwh_ (1hnw H:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
   consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a

4. Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family)

5. Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)

6. Protein Ribosomal protein S8 [56049] (3 species)

7. Species Thermus thermophilus [TaxId:274] [56051] (15 PDB entries)

8. Domain d1hnwh_: 1hnw H: [41471]
   Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_
   complexed with mg, tac, zn

Details for d1hnwh_

PDB Entry: 1hnw, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwh_:

Sequence; same for both SEQRES and ATOM records:

>d1hnwh_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

Timeline for d1hnwh_:

• d1hnwh_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnwh_ appears in SCOP 1.63
  
• d1hnwh_ appears in SCOP 1.67
  
• d1hnwh_ appears in the current release, SCOPe 2.08