Lineage for d1hnzh_ (1hnz H:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137819Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
  4. 137820Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 137821Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 137822Protein Ribosomal protein S8 [56049] (3 species)
  7. 137829Species Thermus thermophilus [TaxId:274] [56051] (11 PDB entries)
  8. 137834Domain d1hnzh_: 1hnz H: [41470]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_

Details for d1hnzh_

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

SCOP Domain Sequences for d1hnzh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzh_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d1hnzh_:

Click to download the PDB-style file with coordinates for d1hnzh_.
(The format of our PDB-style files is described here.)

Timeline for d1hnzh_: