Lineage for d1fjgh_ (1fjg H:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334648Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 334649Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 334650Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 334651Protein Ribosomal protein S8 [56049] (3 species)
  7. 334658Species Thermus thermophilus [TaxId:274] [56051] (15 PDB entries)
  8. 334661Domain d1fjgh_: 1fjg H: [41468]
    Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_
    complexed with mg, par, scm, sry, zn

Details for d1fjgh_

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgh_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d1fjgh_:

Click to download the PDB-style file with coordinates for d1fjgh_.
(The format of our PDB-style files is described here.)

Timeline for d1fjgh_: