Lineage for d1clid2 (1cli D:3171-3345)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978140Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2978141Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2978142Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)
  6. 2978143Protein Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain [56044] (2 species)
  7. 2978144Species Escherichia coli [TaxId:562] [56045] (1 PDB entry)
  8. 2978148Domain d1clid2: 1cli D:3171-3345 [41462]
    Other proteins in same PDB: d1clia1, d1clib1, d1clic1, d1clid1
    complexed with so4

Details for d1clid2

PDB Entry: 1cli (more details), 2.5 Å

PDB Description: x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution
PDB Compounds: (D:) protein (phosphoribosyl-aminoimidazole synthetase)

SCOPe Domain Sequences for d1clid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clid2 d.139.1.1 (D:3171-3345) Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain {Escherichia coli [TaxId: 562]}
dgskvsdgdvlialgssgphsngyslvrkilevsgcdpqtteldgkpladhllaptriyv
ksvleliekvdvhaiahltgggfweniprvlpdntqavidesswqwpevfnwlqtagnve
hhemyrtfncgvgmiialpapevdkalallnangenawkigiikasdseqrvvie

SCOPe Domain Coordinates for d1clid2:

Click to download the PDB-style file with coordinates for d1clid2.
(The format of our PDB-style files is described here.)

Timeline for d1clid2: