Lineage for d1ffub2 (1ffu B:147-803)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84084Fold d.133: Molybdemum cofactor-binding domain [56002] (1 superfamily)
  4. 84085Superfamily d.133.1: Molybdemum cofactor-binding domain [56003] (1 family) (S)
  5. 84086Family d.133.1.1: Molybdemum cofactor-binding domain [56004] (3 proteins)
  6. 84092Protein Carbon monoxide (CO) dehydrogenase molybdoprotein [56010] (2 species)
  7. 84093Species Hydrogenophaga pseudoflava [TaxId:47421] [56012] (2 PDB entries)
  8. 84096Domain d1ffub2: 1ffu B:147-803 [41423]
    Other proteins in same PDB: d1ffua1, d1ffua2, d1ffub1, d1ffuc1, d1ffuc2, d1ffud1, d1ffud2, d1ffue1, d1ffuf1, d1ffuf2

Details for d1ffub2

PDB Entry: 1ffu (more details), 2.35 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor

SCOP Domain Sequences for d1ffub2:

Sequence, based on SEQRES records: (download)

>d1ffub2 d.133.1.1 (B:147-803) Carbon monoxide (CO) dehydrogenase molybdoprotein {Hydrogenophaga pseudoflava}
idalkpdapvlredlagktsgahgprehhnhiftwgagdkaatdavfanapvtvsqhmyy
prvhpcpletcgcvasfdpikgdlttyitsqaphvvrtvvsmlsgipeskvrivspdigg
gfgnkvgiypgyvcaivasivlgrpvkwvedrvenisttafardyhmdgelaatpdgkil
glrvnvvadhgafdacadptkfpaglfhicsgsydiprahcsvkgvytnkapggvayxxs
frvteavyliermvdvlaqklnmdkaeiraknfirkeqfpyttqfgfeydsgdyhtalkk
vldavdypalraeqaarradpnsptlmgiglvtftevvgagpskmcdilgvgmfdsceir
ihptgsaiarmgtitqgqghqttyaqiiatelgipseviqveegdtstapyglgtygsrs
tpvagaaialaarkihakarkiaahmlevnendldwevdrfkvkgddskfktmadiawqa
yhqppaglepgleavhyydppnftypfgiylcvvdidratgetkvrrfyalddcgtrinp
miiegqihggltegyavamgqqmpfdaqgnllgntlmdyflptavetphwetdhtvtpsp
hhpigakgvaesphvgsiptftaavvdafahvgvthldmphtsyrvwkslkehnlal

Sequence, based on observed residues (ATOM records): (download)

>d1ffub2 d.133.1.1 (B:147-803) Carbon monoxide (CO) dehydrogenase molybdoprotein {Hydrogenophaga pseudoflava}
idalkpdapvlredlagktsgahgprehhnhiftwgagdkaatdavfanapvtvsqhmyy
prvhpcpletcgcvasfdpikgdlttyitsqaphvvrtvvsmlsgipeskvrivspdigg
gfgnkvgiypgyvcaivasivlgrpvkwvedrvenisttafardyhmdgelaatpdgkil
glrvnvvadhgafdacadptkfpaglfhicsgsydiprahcsvkgvytnkapggvaysfr
vteavyliermvdvlaqklnmdkaeiraknfirkeqfpyttqfgfeydsgdyhtalkkvl
davdypalraeqaarradpnsptlmgiglvtftevvgagpskmcdilgvgmfdsceirih
ptgsaiarmgtitqgqghqttyaqiiatelgipseviqveegdtstapyglgtygsrstp
vagaaialaarkihakarkiaahmlevnendldwevdrfkvkgddskfktmadiawqayh
qppaglepgleavhyydppnftypfgiylcvvdidratgetkvrrfyalddcgtrinpmi
iegqihggltegyavamgqqmpfdaqgnllgntlmdyflptavetphwetdhtvtpsphh
pigakgvaesphvgsiptftaavvdafahvgvthldmphtsyrvwkslkehnlal

SCOP Domain Coordinates for d1ffub2:

Click to download the PDB-style file with coordinates for d1ffub2.
(The format of our PDB-style files is described here.)

Timeline for d1ffub2: