Lineage for d1ffve2 (1ffv E:147-803)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84084Fold d.133: Molybdemum cofactor-binding domain [56002] (1 superfamily)
  4. 84085Superfamily d.133.1: Molybdemum cofactor-binding domain [56003] (1 family) (S)
  5. 84086Family d.133.1.1: Molybdemum cofactor-binding domain [56004] (3 proteins)
  6. 84092Protein Carbon monoxide (CO) dehydrogenase molybdoprotein [56010] (2 species)
  7. 84093Species Hydrogenophaga pseudoflava [TaxId:47421] [56012] (2 PDB entries)
  8. 84095Domain d1ffve2: 1ffv E:147-803 [41422]
    Other proteins in same PDB: d1ffva1, d1ffva2, d1ffvb1, d1ffvc1, d1ffvc2, d1ffvd1, d1ffvd2, d1ffve1, d1ffvf1, d1ffvf2

Details for d1ffve2

PDB Entry: 1ffv (more details), 2.25 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava

SCOP Domain Sequences for d1ffve2:

Sequence, based on SEQRES records: (download)

>d1ffve2 d.133.1.1 (E:147-803) Carbon monoxide (CO) dehydrogenase molybdoprotein {Hydrogenophaga pseudoflava}
idalkpdapvlredlagktsgahgprehhnhiftwgagdkaatdavfanapvtvsqhmyy
prvhpcpletcgcvasfdpikgdlttyitsqaphvvrtvvsmlsgipeskvrivspdigg
gfgnkvgiypgyvcaivasivlgrpvkwvedrvenisttafardyhmdgelaatpdgkil
glrvnvvadhgafdacadptkfpaglfhicsgsydiprahcsvkgvytnkapggvayxxs
frvteavyliermvdvlaqklnmdkaeiraknfirkeqfpyttqfgfeydsgdyhtalkk
vldavdypalraeqaarradpnsptlmgiglvtftevvgagpskmcdilgvgmfdsceir
ihptgsaiarmgtitqgqghqttyaqiiatelgipseviqveegdtstapyglgtygsrs
tpvagaaialaarkihakarkiaahmlevnendldwevdrfkvkgddskfktmadiawqa
yhqppaglepgleavhyydppnftypfgiylcvvdidratgetkvrrfyalddcgtrinp
miiegqihggltegyavamgqqmpfdaqgnllgntlmdyflptavetphwetdhtvtpsp
hhpigakgvaesphvgsiptftaavvdafahvgvthldmphtsyrvwkslkehnlal

Sequence, based on observed residues (ATOM records): (download)

>d1ffve2 d.133.1.1 (E:147-803) Carbon monoxide (CO) dehydrogenase molybdoprotein {Hydrogenophaga pseudoflava}
idalkpdapvlredlagktsgahgprehhnhiftwgagdkaatdavfanapvtvsqhmyy
prvhpcpletcgcvasfdpikgdlttyitsqaphvvrtvvsmlsgipeskvrivspdigg
gfgnkvgiypgyvcaivasivlgrpvkwvedrvenisttafardyhmdgelaatpdgkil
glrvnvvadhgafdacadptkfpaglfhicsgsydiprahcsvkgvytnkapggvaysfr
vteavyliermvdvlaqklnmdkaeiraknfirkeqfpyttqfgfeydsgdyhtalkkvl
davdypalraeqaarradpnsptlmgiglvtftevvgagpskmcdilgvgmfdsceirih
ptgsaiarmgtitqgqghqttyaqiiatelgipseviqveegdtstapyglgtygsrstp
vagaaialaarkihakarkiaahmlevnendldwevdrfkvkgddskfktmadiawqayh
qppaglepgleavhyydppnftypfgiylcvvdidratgetkvrrfyalddcgtrinpmi
iegqihggltegyavamgqqmpfdaqgnllgntlmdyflptavetphwetdhtvtpsphh
pigakgvaesphvgsiptftaavvdafahvgvthldmphtsyrvwkslkehnlal

SCOP Domain Coordinates for d1ffve2:

Click to download the PDB-style file with coordinates for d1ffve2.
(The format of our PDB-style files is described here.)

Timeline for d1ffve2: