Lineage for d1qj2h2 (1qj2 H:147-809)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196821Fold d.133: Molybdemum cofactor-binding domain [56002] (1 superfamily)
  4. 196822Superfamily d.133.1: Molybdemum cofactor-binding domain [56003] (1 family) (S)
  5. 196823Family d.133.1.1: Molybdemum cofactor-binding domain [56004] (4 proteins)
  6. 196829Protein Carbon monoxide (CO) dehydrogenase molybdoprotein [56010] (2 species)
  7. 196835Species Pseudomonas carboxydovorans [56011] (1 PDB entry)
  8. 196837Domain d1qj2h2: 1qj2 H:147-809 [41420]
    Other proteins in same PDB: d1qj2a1, d1qj2a2, d1qj2b1, d1qj2c1, d1qj2c2, d1qj2g1, d1qj2g2, d1qj2h1, d1qj2i1, d1qj2i2

Details for d1qj2h2

PDB Entry: 1qj2 (more details), 2.2 Å

PDB Description: co dehydrogenase from oligotropha carboxidovorans

SCOP Domain Sequences for d1qj2h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qj2h2 d.133.1.1 (H:147-809) Carbon monoxide (CO) dehydrogenase molybdoprotein {Pseudomonas carboxydovorans}
vdpfkamepdapllredikdkmtgahgarkhhnhifrweigdkegtdatfakaevvskdm
ftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvirtvvslisglpehkihviapd
igggfgnkvgaysgyvcavvasivlgvpvkwvedrmenlsttsfardyhmttelaatkdg
kilamrchvladhgafdacadpskwpagfmnictgsydmpvahlavdgvytnkasggvay
rxsfrvteavyaieraietlaqrlemdsadlriknfiqpeqfpymaplgweydsgnypla
mkkamdtvgyhqlraeqkakqeafkrgetreimgigisffteivgagpskncdilgvsmf
dsaeirihptgsviarmgtksqgqghettyaqiiatelgipaddimieegntdtapyglg
tygsrstptagaatavaarkikakaqmiaahmlevhegdlewdvdrfrvkglpekfktmk
elawasynspppnlepgleavnyydppnmtypfgayfcimdididtgvaktrrfyalddc
gtrinpmiiegqvhgglteafavamgqeirydeqgnvlgasfmdfflptavetpkwetdy
tvtpsphhpigakgvgesphvggvpcfsnavndayaflnaghiqmphdawrlwkvgeqlg
lhv

SCOP Domain Coordinates for d1qj2h2:

Click to download the PDB-style file with coordinates for d1qj2h2.
(The format of our PDB-style files is described here.)

Timeline for d1qj2h2: